HORDB

General Information

ID: hor006352
Uniprot ID: O09107
Protein name: Insulin-like 3 A chain
Gene name: Insl3
Organism: Mus musculus (Mouse)
Family: Insulin family
Source: animal
Expression: Expressed exclusively in Leydig cells of the testis.
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0002020 protease binding; GO:0005179 hormone activity
GO BP: GO:0001556 oocyte maturation; GO:0001701 in utero embryonic development; GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0008584 male gonad development; GO:0010634 positive regulation of epithelial cell migration; GO:0043066 negative regulation of apoptotic process; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0090303 positive regulation of wound healing; GO:2000018 regulation of male gonad development
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048471 perinuclear region of cytoplasm

Sequence Information

Sequence: SAATNAVHRCCLTGCTQQDLLGLCPH
Length: 26(97-122)
Propeptide: MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPRWSPEATQPVETRDRELLQWLEQRHLLHALVADVDPALDPQLPRQASQRQRRSAATNAVHRCCLTGCTQQDLLGLCPH
Signal peptide: MRAPLLLMLLALGSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
Mechanism: NA
Cross BBB: NA
Target: Rxfp2, Rxfp1
Target Unid: Q91ZZ5, Q6R6I7
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 45945
Structure ID: AF-O09107-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006352_AF2.pdb

hor006352_ESM.pdb

Physical Information

Mass:	315926	Formula:	C110H182N36O36S4
Absent amino acids:	EFIKMWY	Common amino acids:	CL
pI:	7.29	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	8
Hydrophobicity:	17.69	Boman Index:	-2564
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	82.69
Instability Index:	3983.85	Extinction Coefficient cystines:	250
Absorbance 280nm:	10

Literature

PubMed ID: 8770925
Title: Molecular cloning and expression of the relaxin-like factor from the mouse testis.
PubMed ID: 9428631
Title: The mouse relaxin-like factor gene and its promoter are located within the 3' region of the JAK3 genomic sequence.
PubMed ID: 10391220
Title: Cryptorchidism in mice mutant for Insl3.
PubMed ID: 11342953
Title: Leydig insuli
PubMed ID: 21183079
Title: